if you remember this, you deserve a veteran’s discount
@Janex-06
2 жыл бұрын
Im worthy then
@JS-pk8gv
2 жыл бұрын
Ok boomer
@Rosie-mm7dl
2 жыл бұрын
I remember this, so I get a discount then
@jbsMUWcreations2089
Жыл бұрын
I do
@MikeAndRevioAdventures
Жыл бұрын
I remember this one fondly.
@cartmantv6465
4 жыл бұрын
2010▪︎Great 2020▪︎10 years of Masterpiece !
@MattIsTheCat
Жыл бұрын
Man, look how old this comment. We have Windows 11 now.
@diamondshroom3335
8 жыл бұрын
0:23 GET OUT!
@l_Diamond_l
4 жыл бұрын
That’s from the first Terminator movie
@actionfire4036
3 жыл бұрын
*gets hit by shell* WHY YOU LITTLE!!
@xeffy3056
7 жыл бұрын
2:58 7 damn years and im still laughing at this part
@chrisrobson4991
Жыл бұрын
Annie and Clarabel: He's dreadfully rude, I feel quite ashamed. I feel quite ashamed, he's dreadfully rude. [to Mario] You mustn't be rude, you'll make us ashamed.
@milagrosmontes8502
Жыл бұрын
Toad is crying like a man😅
@javianwilliams7463
5 жыл бұрын
1:01 “No biggie. I’m cool!”
@metaljacket8128
6 жыл бұрын
4:28 was NOT expecting that crazy action sequence.
@dededethesuperstarwarrior
9 жыл бұрын
Mario in a very man voice* Get out Koopa: i'm outta here!
@evanhaskel206
5 жыл бұрын
dedede the superstar warrior I’m pretty sure that’s from The Terminator.
@l_Diamond_l
4 жыл бұрын
It is
@jakandratchet9930
7 жыл бұрын
Ok, I must admit, Mario in the epic finale was pretty damn badass. How he survived all those blasts, dodged all those attacks, and used the ships own defences against them, that was really badass. I liked how the "tank2tank" tanks were used as well. That may have been the highlight of the video in my opinion, where Mario did all those stunts. I always thought that was pretty awesome.
@Conman9310
8 жыл бұрын
I remember thinking this was the shit back in 2010 now its just... aged?
@mellosauce
7 жыл бұрын
Conman Epicness As I was scrolling to the comments I was just about to comment that lmao
@julianathye
6 жыл бұрын
Conman Epicness iii
@MrJodyMaus
6 жыл бұрын
nope still is crap
@IWANT94
5 жыл бұрын
@Bold One No.
@blackmad2000
4 жыл бұрын
@Bold One HAHAHAHAHA!!!!
@truonganhtu3705
9 жыл бұрын
Peach : Thank you Mario ! But the princess it in another cas... Mario : (Shoot Peach)
@АндрейМущук-р2д
9 жыл бұрын
rip peach
@tigerguy1013
7 жыл бұрын
Truong Anhtu 2 games of "our princess is in another castle" and Mario had had enough!
@blazinthefirepony
6 жыл бұрын
Mario ain't having that shit, and neither are we.
@kristinglab
6 жыл бұрын
wut peach said was a joke
@LoserZV
6 жыл бұрын
Truong Anhtu Mario : " That's NOT how It's supposed to work!
@anotheruser7534
8 жыл бұрын
2:50 -2:51 Mario's got a damn point there.
@ageeksgamestream5260
7 жыл бұрын
Listen JordanFix it12345, do I tell you how to do YOUR job?
@naktisster
7 жыл бұрын
R.I.P Luigi's Head
@williamj.s.rodriguez4761
6 жыл бұрын
2:24 Pick a Box .Any Box. Mario has piont why not open the others .
@reneliebregts64
6 жыл бұрын
A Geek's GameStream f*ck you toad
@zivi_art
6 жыл бұрын
Yeesss
@xrmax4551
5 жыл бұрын
6:27 I can't stop. Too funny
@heathermay1888
5 жыл бұрын
4:02 Gaurdian: Oh No It's Terrible Find The Magic Wand Like Harry Potter Mario: You Know Can't I Use The Wand From The Other World Gaurdian: NO YOU MUST THE WAND OR ELSE I'LL LOOK STUPID AND NO OFFICIAL ROLE IN THE GAME AND THERE WILL BE ONE REASON YOU HAVE TO COMPLETE THIS GAME AND IF YOU DON'T DO IT THE GAME WILL BE BLAND Mario: Ok Ok Jesus
@mydiascis4517
9 жыл бұрын
Best part: Mario: Hello?BoomBoom:FUYERIUIEJIEIDKWUDIOWUSWODWIFUIFUIFJIWEFJEKFJEOFJROFJROFRJORJFORJROFJROFMROGJROLKROGKROGRJOGJROGJROGKROJKGRLGJKTOGJTOLJGOJTOJGLJKGOJLGJTIRFJJRIHRIKJFEFIOJOGURORJIROJFOFGRLRJOFJRORJROUTORTUROJORROUJRJORUJROURORJROJORJRGOGJRGO Mario:Im done with this! *shots boom boom*
@circuit10
7 жыл бұрын
mydias cis Put subtitles on
@kevincox8905
6 жыл бұрын
mydias cis ii
@Wamiloop
4 жыл бұрын
it's not hello it's yellow
@xxxranchoxxx9494
8 жыл бұрын
3:24 active subtitles xD
@heathermay1888
5 жыл бұрын
5:20 Mario: Imma Join The Winter Olyimpic's Someday And Im Gonna Do With Friends (Year's Later) (Mario Look's At The Screen While You're Playing The Game :Mario And Sonic At The Winter Olyimpic's) Mario: Told'Cha
@fukyeah1000
6 жыл бұрын
3:26 When soneone wakes you up at 6 AM
@Tyler-qv2jv
9 жыл бұрын
My favorite one is boom boom
@shookums265
6 жыл бұрын
same
@RanmaChan
4 жыл бұрын
Agree!
@Hai_Farded_Rn
4 жыл бұрын
Same
@redwannightcore8221
3 жыл бұрын
🤣🤣🤣
@SirBahamut0425
2 ай бұрын
I die of laughter every time watching that one.
@truonganhtu3705
9 жыл бұрын
Mario : Yello ? Boom Boom : FRKWHKLHEMFNFUFPDIQJAKDKDOMRFKNNVMVHKOPWPAAOSKDMMFMCJDPQIKDWLDMDSPODMQLSMDLDKDMDMSKDDKDMDMXLSALQDMDMLKFFRFNKDLDLDDMDMDMDDMDMDLSKDPWKDMADWPQKWOW CBVVBFLWPJFKAOAPQODKCGNHIEOSSKSNFKEDKEOSPQOWLDMXLXPCKVNVNVMQOPQSOEKFKALQPAPKEKFQPODFIMFOAWPKQOEKQODMQOKDMCWQPAOEKQPSKLAOKSLSSIPAKSIOSPAOKDKSDODKDODIDPADK Mario : (Shoot Boom Boom)
@SeanWallaWalla
6 жыл бұрын
This is one of my favorite mario parodies of the classic years of KZitem **Sigh** i really miss those days
@shimmercode_gamer156
4 жыл бұрын
6:28 Thank you Mario But A Princess is Another Cas 😂😂😂😂
@jcvm07
5 жыл бұрын
5:10 T-Pose XD
@sapphirebulletbill
7 жыл бұрын
0:16 Poor Luigi
@luciuszamora1069
4 жыл бұрын
That sound it like that hurt
@Super71_lpc
Ай бұрын
It's a Mario 64 scream slowed down@@luciuszamora1069
@InessaMaxinova
7 жыл бұрын
MAH BOI
@TheFanatAB
5 жыл бұрын
Море?
@chrisketchum8042
5 жыл бұрын
@@TheFanatAB watch zelda cdi cutscenes
@mister54336.
6 ай бұрын
You saved me
@InessaMaxinova
6 ай бұрын
I forgot I made this comment. Damn.
@mister54336.
6 ай бұрын
@@InessaMaxinova your back from the dead since 7 years
@AshtiDeonarine
11 жыл бұрын
Best part was the boom boom, bussing out of nowhere looking like it dancing punjabi, and then Mario shoots the hell out of that weirdo. Hell that was funny!!!!
@simonanderson9021
7 жыл бұрын
1:45 - In your face, Green Mario.
@raymonde4198
8 жыл бұрын
The most beautiful video ever... I almost cried.
@dankmemewarrior1475
6 жыл бұрын
Shut yo sensitive ass up.
@dankmemewarrior1475
6 жыл бұрын
Nevermind. I just cried.
@krabsthederpypirate2791
6 жыл бұрын
3:26 crazy uganda knuckles confirmed
@krabsthederpypirate2791
6 жыл бұрын
he saids *something* brotha!
@redshepherd32
12 жыл бұрын
5:40-5:55 newsgrounds to the rescue also, Mario: Thank You King: Mah Boi, this is what all true warriors strive for Mario: No kidding, I am so getting myself a tank
@Unicysis
6 жыл бұрын
0:17 - PMSL 😂🤣😆😂😂 Luigi’s face when he lands on top of the Spiny !!!!!!
@jasonadams5971
2 жыл бұрын
0:02 Homer Simpson’s D’oh!
@slushysapphirestoneest.2003
6 жыл бұрын
“Why you little” by Homer Simpson
@heathermay1888
5 жыл бұрын
2:07 Mario Isn't A Nuke
@staticystars
9 жыл бұрын
0:25 Naked koopa XD
@carolynwyattiii2129
7 жыл бұрын
Jellybean Plays same
@thisispkmadness
4 жыл бұрын
XD moment
@MrNight-lk3qb
3 ай бұрын
2:58 That crying is the funniest. 🤣🤣
@t-rkplayzgames6737
6 жыл бұрын
I always loved this video even as 10 years old
@jedmM
7 жыл бұрын
4:41 its roy koopa!!!
@CeaselessEntertainment8468
Жыл бұрын
3:26 me explaining to the world history teacher the way to solve world hunger is the same way to solve overpopulation
@RileyCutie5
3 жыл бұрын
Finbar: (Calls Terrence a thing) Terrence: 2:58
@jeantomita3085
9 жыл бұрын
Boom Boom talks gibberish while on drugs! LOL
@tristanhill6211
8 жыл бұрын
Toad- Pick a box. Its context will help you in the way. Mario- dawn............dawn..... Toad - Wait... but what are you doing? Mario- I'm opening other boxes. Toad - So you try to get a lot? Mario- What?........I need help to pick my get! Are you in my side or not?! Toad - Listen Mr. Plmuber. Did I tell you can do my job? Mario- F""k you, Toad! Toad - fake crying
@milagrosmontes8502
Жыл бұрын
2:57 Toad is fake crying 😭
@Mariothehedgehog321
10 жыл бұрын
Mah Boi! You saved me!
@WWChampion16
9 жыл бұрын
I can't stop laughing at Toad's crying.
@carolynwyattiii2129
7 жыл бұрын
Rainbow Dash 4Ever me too 😂😂😂
@reneliebregts64
6 жыл бұрын
F**k you toad XD
@chrisrobson4991
Жыл бұрын
Annie and Clarabel: He's dreadfully rude, I feel quite ashamed. I feel quite ashamed, he's dreadfully rude.
@BenM64
7 жыл бұрын
Would you happen to remember what inspired the scene with Boom Boom (3:10)? Did his gibberish voice come from elsewhere on the web, or was it your own recording? (Either way, the hilarious absurdity of the scene almost made me fall off my chair in laughter.)
@tigerguy1013
7 жыл бұрын
Ben Roberts the hell with this *boom*
@tank2tank
7 жыл бұрын
Nah, it's just me recording myself, pitch shifted. As for what inspired it? God knows. I guess I thought he looked nuts. Also, Merry Christmas: dl.dropboxusercontent.com/u/2778081/boom%20boom%20isolated%20audio.mp3
@BenM64
7 жыл бұрын
tank2tank Maybe you saw Boom Boom's movement patterns, thought he looked a little weird, then decided to exaggerate the craziness? It certainly worked; it made my 12-year-old self laugh for a good 10 minutes, maybe more, along with a few other "Stupid Mario Bros" scenes! Even at the age of 18, I still crack up at Boom Boom's gibberish! It would've been hilarious if Nintendo decided to make that Boom Boom's real attack pattern in Super Mario 3D Land!
@freddyfazbeargamer324
9 жыл бұрын
3:26 Boss: Hard and got bogged down to make you happy baby i got your are you having www yet but he did you have made a bigger deal yeah the engineers LTD up did not hear any idea that you know that you have read every time you have a lead lead lead lead lead lead lead lead lead to get PDF you have to be a B&B didn't have been a deadly game tonight... Mario: Gonna be okay *shoot*
Ah I remember this video. One of my first videos that I watched 4 years ago! I always come back to it!
@thisispkmadness
4 жыл бұрын
Oh look a comment from 4 years ago
@Speems
8 жыл бұрын
MAH BOI YOU SAVED ME
@MariachiBro
Жыл бұрын
The Boom Boom part still makes me laugh! 😂
@Tawit2546
5 жыл бұрын
2:57 Mario: F**k you, Toad! Toad: (Crying)
@JamesLucasJL
5 жыл бұрын
🤣😂😅😆
@robertthechannel1799
6 жыл бұрын
0:39 What on earth is that Koopa doing?!
@lovergirlgacha7808
4 жыл бұрын
Oh that's simple when a m on my turkey and a daddy turtle really love each other (you know the rest (˵ ͡° ͜ʖ ͡°˵)
@lovergirlgacha7808
4 жыл бұрын
Ment to say turtle not turkey
@Daniel_R9511
6 жыл бұрын
5:47 THE NEWROUNDS TANK
@baconboi69
Жыл бұрын
*still a masterpiece.*
@zacharylandreneau3901
11 жыл бұрын
The Part with Boom Boom is the best part!
@jdcupp6396
11 жыл бұрын
i love the finale and the music. it remids me the end of mario galaxy
@strangekid64
2 жыл бұрын
Ah yes, this is where I learn my first swear word, and said it to my dad: 5:29
@SaudAhmedShaikh
2 жыл бұрын
Crap isn't even a swear word
@strangekid64
2 жыл бұрын
@@SaudAhmedShaikh well he still punished me for it tho.
@awesomebob9927
10 жыл бұрын
THIS IS MORE FUNNY THAN THE VIDEO OF 2014-2013-2012
@jojow_builder
10 жыл бұрын
Ooooooo
@gamertagger5375
9 жыл бұрын
Its 2015 now....
@xxxranchoxxx9494
8 жыл бұрын
Its 2016 now
@meltedbonddika3859
7 жыл бұрын
Awesomebob99 its 2017 nowdays
@carolynwyattiii2129
7 жыл бұрын
Awesomebob99 ikr
@alexistramirez
2 жыл бұрын
3:26 Boom Boom is so annoying and drunk
@Arcader-cs9bs
8 жыл бұрын
0:23-0:24 - *Mario:* _[Austrian accent]_ Get out. - Arnold Schwarzenegger as T-101, _The Terminator,_ 1984.
@lvciditii2549
8 жыл бұрын
good old days :)
@blu1176
7 жыл бұрын
Oh i'm on this side of youtube again...
@greenknight9000
10 жыл бұрын
0:15 my reaction if football to nuts
@rotatingcat1957
6 жыл бұрын
3:22 mario: *Y E L L O W* boom boom: nvgunjhsjmthsrhdetvhgrtvhjvfhfdtjhvrjthshrtkjdthhergvhfvjjfysjvvvryfghdvtdfsdjjjjjjjjjjjjjjuyrrrrrrrrrrvhjsuvgtthjdsurgvwsehfuuuuuuyrwvvyhdtzyjjrhvuzrrrruyyyyyvyhuhuhuhudZWvtyzrfffff
@LAPO5511
9 ай бұрын
4:34 alarm
@louisbroeglin519
Ай бұрын
Thanks Tank2Tank for my childhood
@Camde667dotcom
4 жыл бұрын
2:36 *D O H*
@SamTheSamsquatch
14 жыл бұрын
The ending was hilarious xD
@ZER0MACHER
8 жыл бұрын
the boom boom part was fucked up...
@MichaelAaronWindle
12 жыл бұрын
@ 0:23, Get out.... Look at him run! LOL
@darkodoric2104
8 жыл бұрын
that song on end at new super mario flash forever
@rossviehman7823
9 жыл бұрын
639 people gave this video a thumbs down for the fact that they actually clicked the screen as directed at the beginning of the video.
@ianpedigo3815
8 жыл бұрын
now its 848
@DxrkSpxce
6 жыл бұрын
You really used the NEWGROUNDS tank
@SmexiBatman
6 жыл бұрын
May boy, you saved me
@romalapin8648
Жыл бұрын
0:16 Luigi did make screaming sound like Mario!
@darksummerend
11 жыл бұрын
da fuq is this?! entertaining ill give it that
@darkodoric4376
9 жыл бұрын
boom boom is crazy
@LEOTHEFREAK1254
11 жыл бұрын
When he does the propeller mushroom then he gets dizzy and falls of a clif
@robertohernandezjr1797
6 жыл бұрын
there's not that much blood we need lots and lots of it hahahahahahahahahaha
@Superpea10
Жыл бұрын
En este Mundo Como Serían eso Para El Italiano y Japonés de Super Mario, Y Por Eso Es Por qué Tenían Unos Pueblos de Hongos y Champiñones Y Para el Año lo Tenían Como Unos Recuerdos Para los Videos De Super Mario
@MrSai-mn8wz
3 жыл бұрын
Damn this is so different now that im older
@tristanhill6211
8 жыл бұрын
Peach - Thank you Mario, but the princess is in other CA's Gun - bang
Пікірлер: 771